AibGenesis™ Mouse Anti-BCKDHA Antibody (CBMOAB-36849FYA)


Cat: CBMOAB-36849FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36849FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36849FYA 100 µg
CBMOAB-67545FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67545FYA 100 µg
MO-AB-08010R Monoclonal Cattle (Bos taurus) WB, ELISA MO08010R 100 µg
MO-AB-14222W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14222W 100 µg
MO-AB-51801W Monoclonal Marmoset WB, ELISA MO51801W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO36849FYA
SpecificityThis antibody binds to Rhesus BCKDHA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe branched-chain alpha-keto acid (BCAA) dehydrogenase (BCKD) complex is an innter mitochondrial enzyme complex that catalyzes the second major step in the catabolism of the branched-chain amino acids leucine, isoleucine, and valine. The BCKD complex consists of three catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a dihydrolipoyl transacylase (E2), and a dihydrolipoamide dehydrogenase (E3). This gene encodes the alpha subunit of the decarboxylase (E1) component. Mutations in this gene result in maple syrup urine disease, type IA. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus BCKDHA Antibody is a mouse antibody against BCKDHA. It can be used for BCKDHA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCKDHA
UniProt IDF7CTI2
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MDSPSLRELQQPLLESTECETPAQKPGRHELGSALREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKHPQCLTYSRCYVSAFGIHA.
For Research Use Only | Not For Clinical Use.
Online Inquiry