Rabbit Anti-BDNF Antibody (MO-DKB-00681W)
Cat: MO-DKB-00681W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Rabbit (Oryctolagus cuniculus) |
| Species Reactivity | Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) |
| Immunogen | The synthetic peptide sequence corresponding to BDNF (brain-derived neurotrophic factor) is selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG. |
| Epitope | The epitope is in the Center of BDNF. |
| Format | Liquid or Lyophilized |
| Buffer | PBS, 2% Sucrose |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | Affinity purified |
Application Information
| Application | WB, IF, IHC, IHC-P |
| Application Notes | Western Blot 1.0 ug/ml Immunohistochemistry 1:200- 1:500 |
Target
| Introduction | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015] |
| Product Overview | This product is a Rabbit antibody against the Center of the BDNF. It can be used for BDNF detection in Western Blot, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Alternative Names | Brain Derived Neurotrophic Factor; Neurotrophin; Abrineurin; Brain-Derived Neurotrophic Factor; ANON2; BULN2; |
| Gene ID | 627 |
| UniProt ID | P23560 |
See other products for " BDNF "
| MOFY-0622-FY118 | Rabbit Anti-BDNF Antibody (MOFY-0622-FY118) |
| MO-AB-06335Y | Mouse Anti-O. anatinus BDNF Antibody (MO-AB-06335Y) |
| CBMOAB-00274FYA | Rabbit Anti-Mouse BDNF Antibody (CBMOAB-00274FYA) |
| MO-DKB-03604W | Rabbit Anti-BDNF (AA 1-100, clone ms2109-012) Antibody (Cat MO-DKB-03604W) |
| MO-AB-00290Y | Mouse Anti-Chicken BDNF Antibody (MO-AB-00290Y) |
| MO-AB-42961W | Mouse Anti-Hamsters BDNF Antibody (MO-AB-42961W) |
| MO-AB-09229W | Mouse Anti-Cat BDNF Antibody (MO-AB-09229W) |
| MOFY-0622-FY3 | Mouse Anti-BDNF Antibody (MOFY-0622-FY3) |
| MO-AB-24357H | Mouse Anti-Rat Bdnf Antibody (MO-AB-24357H) |
| CBMOAB-67619FYA | Mouse Anti-Zebrafish bdnf Antibody (CBMOAB-67619FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry