AibGenesis™ Mouse Anti-BET1 Antibody (CBMOAB-00473CR)
Cat: CBMOAB-00473CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00473CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Maize (Zea mays), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) | WB, ELISA | MO00473CR | 100 µg | ||
| CBMOAB-00933HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO00933HB | 100 µg | ||
| CBMOAB-02381FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02381FYA | 100 µg | ||
| CBMOAB-21855FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO21855FYB | 100 µg | ||
| CBMOAB-36930FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36930FYA | 100 µg | ||
| CBMOAB-67632FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67632FYA | 100 µg | ||
| MO-AB-01838H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01838C | 100 µg | ||
| MO-AB-08059R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08059R | 100 µg | ||
| MO-AB-22862W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22862W | 100 µg | ||
| MO-AB-24360H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24360C | 100 µg | ||
| MO-AB-43850W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43850W | 100 µg | ||
| MO-AB-47483W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47483W | 100 µg | ||
| MO-AB-51850W | Monoclonal | Marmoset | WB, ELISA | MO51850W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Maize (Zea mays), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) |
| Clone | MO00473CR |
| Specificity | This antibody binds to Yeast BET1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus; Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | SNARE required for targeting and fusion of ER-derived transport vesicles with the Golgi complex. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast BET1 Antibody is a mouse antibody against BET1. It can be used for BET1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein transport protein BET1; Suppressor of loss of YPT1 protein 12; Protein SLY12; BET1; SLY12; YIL004C |
| UniProt ID | P22804 |
| Protein Refseq | The length of the protein is 142 amino acids long. The sequence is show below: MSSRFAGGNAYQRDTGRTQLFGPADGSNSLDDNVSSALGSTDKLDYSQSTLASLESQSEEQMGAMGQRIKALKSLSLKMGDEIRGSNQTIDQLGDTFHNTSVKLKRTFGNMMEMARRSGISIKTWLIIFFMVGVLFFWVWIT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry