AibGenesis™ Mouse Anti-BET1L Antibody (CBMOAB-36931FYA)


Cat: CBMOAB-36931FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36931FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36931FYA 100 µg
CBMOAB-67634FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67634FYA 100 µg
MO-AB-01839H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01839C 100 µg
MO-AB-08060R Monoclonal Cattle (Bos taurus) WB, ELISA MO08060R 100 µg
MO-AB-10733Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10733Y 100 µg
MO-AB-22988W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22988W 100 µg
MO-AB-24361H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24361C 100 µg
MO-AB-51852W Monoclonal Marmoset WB, ELISA MO51852W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36931FYA
SpecificityThis antibody binds to Rhesus BET1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionVesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus BET1L Antibody is a mouse antibody against BET1L. It can be used for BET1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBET1L
UniProt IDF7D212
Protein RefseqThe length of the protein is 101 amino acids long.
The sequence is show below: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRESVPCPTTCYRACSVSFSTGAGGWSNHHFCVILPGFFP.
For Research Use Only | Not For Clinical Use.
Online Inquiry