AibGenesis™ Mouse Anti-BEX3 Antibody (MO-AB-08062R)


Cat: MO-AB-08062R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08062R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO08062R 100 µg
MO-AB-12858W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12858W 100 µg
MO-AB-24369H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24369C 100 µg
MO-DKB-01113W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO08062R
SpecificityThis antibody binds to Cattle BEX3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death. May play an important role in the pathogenesis of neurogenetic diseases. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Cattle BEX3 Antibody is a mouse antibody against BEX3. It can be used for BEX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein BEX3; Brain-expressed X-linked protein 3 homolog; Nerve growth factor receptor-associated protein 1; p75NTR-associated cell death executor; NGFRAP1; BEX3 NADE
UniProt IDQ3ZBJ6
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: MANIHQENEEMEQPVQNGEEDRPLGGGEGHQPERNHRRGQARRLAPNFRWVIPNRQVNDGMGGEGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP.
For Research Use Only | Not For Clinical Use.
Online Inquiry