AibGenesis™ Mouse Anti-BGLU12 Antibody (CBMOAB-21882FYB)


Cat: CBMOAB-21882FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-21882FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO21882FYB 100 µg
CBMOAB-25217FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO25217FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO21882FYB
SpecificityThis antibody binds to Rice BGLU12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice BGLU12 Antibody is a mouse antibody against BGLU12. It can be used for BGLU12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-glucosidase 12; Os4bglu12; EC 3.2.1.21; BGLU12; Os04g0474800 LOC_Os04g39880
UniProt IDQ7XKV4
Protein RefseqThe length of the protein is 510 amino acids long.
The sequence is show below: MAAAGAMPGGLLLTFLLLAVVASGAYNGAGEPPVSRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICFKEFGDRVKNWITFNEPWTFCSNGYATGLFAPGRCSPWEKGNCSVGDSGREPYTACHHQLLAHAETVRLYKAKYQALQKGKIGITLVSHWFVPFSRSKSNDDAAKRAIDFMFGWFMDPLIRGDYPLSMRGLVGNRLPQFTKEQSKLVKGAFDFIGLNYYTANYADNLPPSNGLNNSYTTDSRANLTGVRNGIPIGPQAASPWLYVYPQGFRDLLLYVKENYGNPTVYITENGVDEFNNKTLPLQEALKDDARIEYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYNDGRKRYPKNSAHWFKKFLLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry