AibGenesis™ Mouse Anti-bhlha9 Antibody (CBMOAB-67657FYA)


Cat: CBMOAB-67657FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67657FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO67657FYA 100 µg
Inquiry
MO-AB-24373H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24373C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO67657FYA
SpecificityThis antibody binds to Zebrafish bhlha9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the basic helix-loop-helix family. The encoded protein is a transcription factor involved in limb development. Mutations in this gene have been associated with mesoaxial synostotic syndactyly Malik-Percin type (MSSD). Copy number variation of a locus containing this gene has been linked to a form of split-hand/foot malformation with long bone deficiency (SHFLD3). (From NCBI)
Product OverviewMouse Anti-Zebrafish bhlha9 Antibody is a mouse antibody against bhlha9. It can be used for bhlha9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesClass A basic helix-loop-helix protein 9; bHLHa9; Class B basic helix-loop-helix factor 42; bHLHf42; bhlha9; bhlhf4
UniProt IDA3KNX5
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MTPVSVCRFSMASRGSFTGSEFSEEEPDGSLQESELDSSDGLGGLNEPEERLIKKRSRPVRSKARRVAANVRERKRILDYNQAFNALRVALHHDLSGKRLSKIATLQRAINRISALSVFLTNNPPVGVAKPCGHLECQPGGLWAEAEPSMQNFLTWHQPLNQHLQTSIHRLSSEQHVFTGPACPPSPHYPCFSPDTQLYPAASVPSPPRYGRIGDVGAYQQGVWGGNHADGYGESLQTLPLPWHMGYLQDAGLQHCPNTLCYTQCKTVRAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry