AibGenesis™ Mouse Anti-BRMS1L Antibody (CBMOAB-37117FYA)


Cat: CBMOAB-37117FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37117FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO37117FYA 100 µg
MO-AB-09143R Monoclonal Cattle (Bos taurus) WB, ELISA MO09143R 100 µg
MO-AB-21979W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21979W 100 µg
MO-AB-24426H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24426C 100 µg
MO-AB-51957W Monoclonal Marmoset WB, ELISA MO51957W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO37117FYA
SpecificityThis antibody binds to Rhesus BRMS1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene shows sequence similarity to the human breast carcinoma metastasis suppressor (BRMS1) protein and the mammalian Sds3 (suppressor of defective silencing 3) proteins. This protein is a component of the mSin3a family of histone deacetylase complexes (HDAC). (From NCBI)
Product OverviewMouse Anti-Rhesus BRMS1L Antibody is a mouse antibody against BRMS1L. It can be used for BRMS1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBRMS1L
UniProt IDF7DCP1
Protein RefseqThe length of the protein is 324 amino acids long.
The sequence is show below: MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVYFGNIIQIYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry