Mouse Anti-Bromus PIN1 Antibody (MO-AB-01899L)
Cat: MO-AB-01899L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Bromus (Bromus vulgaris) |
Clone | MO01899L |
Specificity | This antibody binds to Bromus PIN1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene. |
Product Overview | This product is a mouse antibody against PIN1. It can be used for PIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Serine proteinase inhibitor; PIN1 |
UniProt ID | Q6TCI2 |
Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: MSSSSVGEVTKSWPEVVGLSIKEAKKVILKDKPDADIVALPVGGKVTDDFLSNRVRIFVDTGGEIPRAG. |
See other products for " PIN1 "
CBMOAB-38872FYC | Mouse Anti-Arabidopsis PIN1 Antibody (CBMOAB-38872FYC) |
MO-AB-00818H | Mouse Anti-Arabidopsis PIN1 Antibody (MO-AB-00818H) |
MO-AB-61554W | Mouse Anti-Marmoset PIN1 Antibody (MO-AB-61554W) |
MO-AB-17942R | Mouse Anti-Cattle PIN1 Antibody (MO-AB-17942R) |
CBMOAB-92662FYA | Mouse Anti-Zebrafish pin1 Antibody (CBMOAB-92662FYA) |
MO-DKB-02207W | Rabbit Anti-PIN1 Antibody (MO-DKB-02207W) |
MO-AB-27882H | Mouse Anti-Rat Pin1 Antibody (MO-AB-27882H) |
MO-DKB-04086W | Rabbit Anti-PIN1 (C-terminal) Antibody (Cat MO-DKB-04086W) |
MO-DKB-02765W | Rabbit Anti-PIN1 Antibody (MO-DKB-02765W) |
MO-AB-00480W | Mouse Anti-Barrel medic PIN1 Antibody (MO-AB-00480W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry