Mouse Anti-Cattle PIN1 Antibody (MO-AB-17942R)


Cat: MO-AB-17942R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17942R
SpecificityThis antibody binds to Cattle PIN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPeptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer''s disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]
Product OverviewThis product is a mouse antibody against PIN1. It can be used for PIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeptidyl-prolyl cis-trans isomerase NIMA-interacting 1; EC 5.2.1.8; Peptidyl-prolyl cis-trans isomerase Pin1; PPIase Pin1; Rotamase Pin1; PIN1
UniProt IDQ5BIN5
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSGSGKNGQGEPTRVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry