AibGenesis™ Mouse Anti-BSND Antibody (CBMOAB-37137FYA)


Cat: CBMOAB-37137FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37137FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO37137FYA 100 µg
CBMOAB-67998FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67998FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO37137FYA
SpecificityThis antibody binds to Rhesus BSND.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. (From NCBI)
Product OverviewMouse Anti-Rhesus BSND Antibody is a mouse antibody against BSND. It can be used for BSND detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBSND
UniProt IDF6YZV7
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSIMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMESPSPQPPYVRLWEEAAYDQSLPDFNHIQMKVMSYSEDPRPLLAPDTGQSWEPVMEEKVWRRSGLGGGRRGHPQGLRRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry