AibGenesis™ Mouse Anti-bst-2B Antibody (MO-AB-09161R)


Cat: MO-AB-09161R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09161R Monoclonal Cattle (Bos taurus), Sheep (Ovis aries) WB, ELISA MO09161R 100 µg
MO-AB-14405Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14405Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Sheep (Ovis aries)
CloneMO09161R
SpecificityThis antibody binds to Cattle bst-2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle bst-2B Antibody is a mouse antibody against bst-2B. It can be used for bst-2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBone marrow stromal antigen 2 type B; bst-2B
UniProt IDJ7M2B2
Protein RefseqThe length of the protein is 170 amino acids long.
The sequence is show below: MDTEEDMSEFLMPIDKEKDSSESALCGRKLPLWLGLLLLLVAVGLLVPMIYFAVIANSKACVDGLQAQKECQEVNQHVQRQLNQAQELLHKKEAEAATCKQAVVTLRDSLKKEQARVEELQGELASLNQQLQDALTKERRKSEASAEDNGSVWFFMLLMCTFIIRKCLKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry