Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-C. elegans COX15 Antibody (CBMOAB-00020HCB)


Cat: CBMOAB-00020HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans)
CloneMO00020HB
SpecificityThis antibody binds to C. elegans COX15.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX15 (COX15, Cytochrome C Oxidase Assembly Homolog) is a Protein Coding gene. Diseases associated with COX15 include Cardioencephalomyopathy, Fatal Infantile, Due To Cytochrome C Oxidase Deficiency 2 and Leigh Syndrome. Among its related pathways are Metabolism and Porphyrin and chlorophyll metabolism. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity and oxidoreductase activity, acting on the CH-CH group of donors.
Product OverviewMouse Anti-C. elegans COX15 (clone MO00020HB) Antibody (CBMOAB-00020HCB) is a mouse antibody against COX15. It can be used for COX15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome OXidase assembly protein; cox-15
Gene ID174712
UniProt IDQ22251
Protein RefseqThe length of the protein is 395 amino acids long. The sequence is show below: MWLLASKQLTKFSQLPRVSLLSQGIQNVRQGFRRNFGISVKDVDDKSRKRIGWWLMGCAGMCYGAVALGGVTRLTESGLSMVNWDLFRTMKPPFGQKQWEEEFEKYKAYPEYKYKSSSEEMTLNEFKFIWSMEYGHRMWGRAIGIVFLIPCAYFWARGRFAPDMKRRMALATTLLLAQGGIGWWMVKSGLDPSKNSSDVPRVSQYRLATHLTMAFVLYSIFFWNGLSHLVKPHDLSKVRSKLGALRGMTHGSKLMVFSTAIMGAFVAGLDAGLVYNSWPKFAENWIPENMLSRSPTWKNFFENDVTVQFVHRNLAYLTVISVLSTFLIGRRAPIPKRTRMALNLTVAAVFGQAALGVFTLINYVPVWLAACHQSGSMALLSSVLWLSHELRRLPK.
For Research Use Only | Not For Clinical Use.

Online Inquiry