Mouse Anti-C. elegans MRPS16 Antibody (CBMOAB-06844HCB)
Cat: CBMOAB-06844HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO06844HB |
Specificity | This antibody binds to C. elegans MRPS16. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described. |
Product Overview | Mouse Anti-C. elegans MRPS16 Antibody is a mouse antibody against MRPS16. It can be used for MRPS16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Probable 28S ribosomal protein S16, mitochondrial; MRP-S16; S16mt; mrps-16 |
UniProt ID | Q10129 |
Protein Refseq | The length of the protein is 147 amino acids long. The sequence is show below: MRKLVIPKYYGRPSIGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQKNEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRAKDNRALIADQQLKVAAEAAEAEKVAQEQASTGAAATSHPQ. |
See other products for " Mrps16 "
CBMOAB-24753FYA | Mouse Anti-D. melanogaster Mrps16 Antibody (CBMOAB-24753FYA) |
CBMOAB-02427CR | Mouse Anti-Yeast MRPS16 Antibody (CBMOAB-02427CR) |
MO-AB-05317H | Mouse Anti-Frog mrps16 Antibody (MO-AB-05317H) |
CBMOAB-87435FYA | Mouse Anti-Zebrafish mrps16 Antibody (CBMOAB-87435FYA) |
MO-AB-26064W | Mouse Anti-Chimpanzee MRPS16 Antibody (MO-AB-26064W) |
MO-AB-59368W | Mouse Anti-Marmoset MRPS16 Antibody (MO-AB-59368W) |
MO-AB-27228H | Mouse Anti-Rat Mrps16 Antibody (MO-AB-27228H) |
MO-AB-16047R | Mouse Anti-Cattle MRPS16 Antibody (MO-AB-16047R) |
MO-AB-35147W | Mouse Anti-Ferret MRPS16 Antibody (MO-AB-35147W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry