AibGenesis™ Mouse Anti-C1QL3 Antibody (CBMOAB-37598FYA)


Cat: CBMOAB-37598FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37598FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO37598FYA 100 µg
MO-AB-24454H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24454C 100 µg
MO-AB-52015W Monoclonal Marmoset WB, ELISA MO52015W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO37598FYA
SpecificityThis antibody binds to Rhesus C1QL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C1QL3 Antibody is a mouse antibody against C1QL3. It can be used for C1QL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement C1q-like protein 3; C1QL3
UniProt IDH9FB00
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: RLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD.
For Research Use Only | Not For Clinical Use.
Online Inquiry