Mouse Anti-c1qtnf2 Antibody (CBMOAB-68275FYA)


Cat: CBMOAB-68275FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-68275FYA Monoclonal Zebrafish (Danio rerio), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO68275FYA 100 µg
CBMOAB-37600FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO37600FYA 100 µg
MO-AB-24219R Monoclonal Pig (Sus scrofa) WB, ELISA MO24219R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO68275FYA
SpecificityThis antibody binds to Zebrafish c1qtnf2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish c1qtnf2 Antibody is a mouse antibody against c1qtnf2. It can be used for c1qtnf2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesc1qtnf2; C1q And TNF Related 2
UniProt IDE7F6Z0
Protein RefseqThe length of the protein is 292 amino acids long.
The sequence is show below: MHQLPLAVCLLLSLLTVDSSKKGRNLTIHSSQLSCSLPGPQGPPGSPGSAGPSGGMGKMGMPGVDGQDGKDGDGGEKGEKGEQGRPGYPGKHGPLGRPGLVGKAGVRGPKGVRGPPGVSGAAGVKGEPGDVGETGPPGGCDCGAEARSAFSVAVTKSYPKERTPIRFNRILMNEGGHYNSTSGKFNCVIPGVYYFTYDITLANKHLAIGLVHNGQYKIRTFDANTGNYDVASGSTILRLQKGDQVWLQIFYSEQNGLFFDPFWTDSLFTGFLIFADQAEPPNEKMTNNSGSS.
See other products for " C1QTNF2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry