AibGenesis™ Mouse Anti-C1QTNF4 Antibody (CBMOAB-37601FYA)


Cat: CBMOAB-37601FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37601FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO37601FYA 100 µg
CBMOAB-68278FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO68278FYA 100 µg
MO-AB-01969H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01969C 100 µg
MO-AB-52018W Monoclonal Marmoset WB, ELISA MO52018W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO37601FYA
SpecificityThis antibody binds to Rhesus C1QTNF4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus C1QTNF4 Antibody is a mouse antibody against C1QTNF4. It can be used for C1QTNF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement C1q tumor necrosis factor-related protein 4; C1QTNF4
UniProt IDH9F4L5
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: APPEPRSAFSAARTRSLVGSDAGSGPRHRPLSFDTELVNIGGDFDAAAGVFRCRLPGAYFFSFTLGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGAPELL.
For Research Use Only | Not For Clinical Use.
Online Inquiry