Mouse Anti-CA2 Antibody (CBMOAB-37955FYA)
Cat: CBMOAB-37955FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-37955FYA | Monoclonal | Rhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Human, Mouse, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus, Pig, Sheep (Ovis aries) | WB, ELISA | MO37955FYA | 100 µg | ||
CBMOAB-25628FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO25628FC | 100 µg | ||
MO-AB-23920W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23920W | 100 µg | ||
MO-AB-52041W | Monoclonal | Marmoset | WB, ELISA | MO52041W | 100 µg | ||
MO-AB-09357R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09357R | 100 µg | ||
MO-AB-01990H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01990C | 100 µg | ||
MO-AB-07385Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07385Y | 100 µg | ||
MO-AB-10784Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10784Y | 100 µg | ||
MO-AB-14421Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14421Y | 100 µg | ||
MO-DKB-02939W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
MOFY-0722-FY81 | Polyclonal | Rhesus | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY99 | Polyclonal | Rhesus | WB, IHC, ICC | 100 µg | |||
MOFY-0722-FY127 | Polyclonal | Rhesus, Human | WB, IHC, ICC | 100 µg | |||
MOFY-0722-FY221 | Polyclonal | Dog, Human, Mouse | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY450 | Polyclonal | Rhesus, Human, Mouse, Pig | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Human, Mouse, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus, Pig, Sheep (Ovis aries) |
Clone | MO37955FYA |
Specificity | This antibody binds to Rhesus CA2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma Membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus CA2 Antibody is a mouse antibody against CA2. It can be used for CA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CA2 |
UniProt ID | F6TQ14 |
Protein Refseq | The length of the protein is 260 amino acids long. The sequence is show below: MSHHWGYGKHNGPEHWHKDFPIAKGQRQSPVDINTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFNVEFDDSQDKAVIKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQMSKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK. |
See other products for " ca2 "
CBMOAB-68377FYA | Mouse Anti-ca2 Antibody (CBMOAB-68377FYA) |
MOFY-0622-FY113 | Biotin conjugated Polyclonal antibody to CA2 (MOFY-0622-FY113) |
MO-AB-34235H | Mouse Anti-ca2 Antibody (MO-AB-34235H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry