Mouse Anti-ca2 Antibody (CBMOAB-68377FYA)


Cat: CBMOAB-68377FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-68377FYA Monoclonal Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Human, Mouse, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus, Pig, Sheep (Ovis aries) WB, ELISA MO68377FYA 100 µg
CBMOAB-25628FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO25628FC 100 µg
MO-AB-23920W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23920W 100 µg
MO-AB-52041W Monoclonal Marmoset WB, ELISA MO52041W 100 µg
MO-AB-09357R Monoclonal Cattle (Bos taurus) WB, ELISA MO09357R 100 µg
MO-AB-01990H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01990C 100 µg
MO-AB-07385Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07385Y 100 µg
MO-AB-10784Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10784Y 100 µg
MO-AB-14421Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14421Y 100 µg
MO-DKB-02939W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MOFY-0722-FY81 Polyclonal Rhesus WB, IHC, ICC, IP 100 µg
MOFY-0722-FY99 Polyclonal Rhesus WB, IHC, ICC 100 µg
MOFY-0722-FY127 Polyclonal Rhesus, Human WB, IHC, ICC 100 µg
MOFY-0722-FY221 Polyclonal Dog, Human, Mouse WB, IHC, ICC, IP 100 µg
MOFY-0722-FY450 Polyclonal Rhesus, Human, Mouse, Pig WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Human, Mouse, Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus, Pig, Sheep (Ovis aries)
CloneMO68377FYA
SpecificityThis antibody binds to Zebrafish ca2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish ca2 Antibody is a mouse antibody against ca2. It can be used for ca2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarbonic anhydrase II; ca
UniProt IDQ6PFU7
Protein RefseqThe length of the protein is 260 amino acids long.
The sequence is show below: MADHWGYDKHNGPDKWGESYPIANGSRQSPIDIKSSTTTYDEKLTPLKLKYDPSTSLDIQNNGHSFQVSFVDDQNSSTLTGGPVTGTFRLKQFHFHWGSADDKGSEHTVNGKCYPAELHLVHWNTKYPSFKDAVDKPDGLAVVGIFLKIGADNPKLQKILDAMDAIKSKGKQTPFPNFDPSVLLPSSLDYWTYLGSLTTPPLLESVTWIVCKQSISVSSAQMKRFRSLLFSGDGEKACCMVNNYRPPQPLKGRVVRASFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry