AibGenesis™ Mouse Anti-CASP3 Antibody (CBMOAB-25710FYC)
Cat: CBMOAB-25710FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-25710FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Hamsters (Cricetinae), Horse (Equus caballus), Human, Mouse, Rat, Rabbit, Chicken, Guinea Pig, Hamster, Monkey, Sheep, Bovine, Canine, Porcine, Yeast, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish | WB, ELISA | MO25710FC | 100 µg | ||
| CBMOAB-38178FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38178FYA | 100 µg | ||
| MO-AB-00983Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00983Y | 100 µg | ||
| MO-AB-07440Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07440Y | 100 µg | ||
| MO-AB-08320W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08320W | 100 µg | ||
| MO-AB-09514R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09514R | 100 µg | ||
| MO-AB-10800Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10800Y | 100 µg | ||
| MO-AB-14446Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14446Y | 100 µg | ||
| MO-AB-16426W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16426W | 100 µg | ||
| MO-AB-29335W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29335W | 100 µg | ||
| MO-AB-34481W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34481W | 100 µg | ||
| MO-AB-36856W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36856W | 100 µg | ||
| MO-AB-42981W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO42981W | 100 µg | ||
| MO-AB-43906W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43906W | 100 µg | ||
| MOFAB-004W | Polyclonal | Zebrafish | ELISA, WB, IP, IF | 100 µg | |||
| MOFAB-043W | Polyclonal | Human, Mouse, Rat, Rabbit, Chicken, Guinea Pig, Hamster, Monkey, Sheep, Bovine, Canine, Porcine, Yeast | WB, IHC | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Hamsters (Cricetinae), Horse (Equus caballus), Human, Mouse, Rat, Rabbit, Chicken, Guinea Pig, Hamster, Monkey, Sheep, Bovine, Canine, Porcine, Yeast, O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish |
| Clone | MO25710FC |
| Specificity | This antibody binds to Arabidopsis CASP3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Cell Wall; Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis CASP3 Antibody is a mouse antibody against CASP3. It can be used for CASP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Caspase 3; Caspase 3, Apoptosis-Related Cysteine Peptidase; Caspase 3, Apoptosis-Related Cysteine Protease; SREBP Cleavage Activity 1; Cysteine Protease CPP32; Protein Yama; EC 3.4.22.56; Apopain; CASP-3 |
| UniProt ID | Q9ZQI2 |
| Protein Refseq | The length of the protein is 221 amino acids long. The sequence is show below: MDIEKAGSRREEEEPIVQRPKLDKGKGKAHVFAPPMNYNRIMDKHKQEKMSPAGWKRGVAIFDFVLRLIAAITAMAAAAKMATTEETLPFFTQFLQFQADYTDLPTMSSFVIVNSIVGGYLTLSLPFSIVCILRPLAVPPRLFLILCDTVMMGLTLMAASASAAIVYLAHNGNSSSNWLPVCQQFGDFCQGTSGAVVASFIAATLLMFLVILSAFALKRTT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry