AibGenesis™ Mouse Anti-casp3a Antibody (CBMOAB-69077FYA)


Cat: CBMOAB-69077FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69077FYA Monoclonal Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO69077FYA 100 µg
MO-AB-10794Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10794Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss)
CloneMO69077FYA
SpecificityThis antibody binds to Zebrafish casp3a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish casp3a Antibody is a mouse antibody against casp3a. It can be used for casp3a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namescasp3a
UniProt IDB8JK21
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: MNGDCVDAKRVDTTDASKDGASASQPMQVDAKPQSHAFRYSLNYPNIGHCIIINNKNFDRRTGMNPRNGTDVDAGNVMNVFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCASLVCVLLSHGDEGVFFGTDTSVDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGVETDHPDHPDIPDGRVRIPVEADFLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTKYGSELELLQIMTRVNHKVALDFESTSNMPGFDAKKQIPCIVSMLTKEMYFTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry