AibGenesis™ Mouse Anti-CASP8AP2 Antibody (CBMOAB-38189FYA)


Cat: CBMOAB-38189FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38189FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO38189FYA 100 µg
CBMOAB-69098FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69098FYA 100 µg
MO-AB-10524W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10524W 100 µg
MO-AB-52290W Monoclonal Marmoset WB, ELISA MO52290W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO38189FYA
SpecificityThis antibody binds to Rhesus CASP8AP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CASP8AP2 Antibody is a mouse antibody against CASP8AP2. It can be used for CASP8AP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCASP8AP2
UniProt IDF7GDV3
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: MAADDDNGDGTSLFDVFSASPLKNNDEGSLDIYAGLDSAVSDSASKSCVPSRNCLDLYEEILTEEGTAKEATYNDLQVEYGKCQLQMKELMKKFKEIQTQNFSLINENQSLKKNISALIKTARVEINRKDEEISNLHQRNDDREILLECQKRGPSFKTFAYLATKLDKNPNQVSERFQQLMKLFEKSKCR.
For Research Use Only | Not For Clinical Use.
Online Inquiry