Mouse Anti-Cat ACVRL1 Antibody (MO-AB-09629W)
Cat: MO-AB-09629W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cat (Felis catus) |
Clone | MO09629W |
Specificity | This antibody binds to Cat ACVRL1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. |
Product Overview | Mouse Anti-Cat ACVRL1 Antibody is a mouse antibody against ACVRL1. It can be used for ACVRL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Activin A receptor type II-like 1; ACVRL1 |
UniProt ID | B0I548 |
Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: TSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSR. |
See other products for " acvrl1 "
CBMOAB-64834FYA | Mouse Anti-Zebrafish acvrl1 Antibody (CBMOAB-64834FYA) |
MO-AB-23520R | Mouse Anti-Pig ACVRL1 Antibody (MO-AB-23520R) |
CBMOAB-35058FYA | Mouse Anti-Rhesus ACVRL1 Antibody (CBMOAB-35058FYA) |
MO-AB-25429W | Mouse Anti-Chimpanzee ACVRL1 Antibody (MO-AB-25429W) |
MO-AB-50410W | Mouse Anti-Marmoset ACVRL1 Antibody (MO-AB-50410W) |
MO-AB-14087Y | Mouse Anti-Sheep ACVRL1 Antibody (MO-AB-14087Y) |
MO-AB-06977R | Mouse Anti-Cattle ACVRL1 Antibody (MO-AB-06977R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry