Mouse Anti-Cat CCR2 Antibody (MO-AB-08436W)


Cat: MO-AB-08436W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08436W
SpecificityThis antibody binds to Cat CCR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCR2 (C-C Motif Chemokine Receptor 2) is a Protein Coding gene. Diseases associated with CCR2 include Idiopathic Anterior Uveitis and Cd3zeta Deficiency. Among its related pathways are Cytokine Signaling in Immune system and Defensins. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is CCR5.
Product OverviewMouse Anti-Cat CCR2 Antibody is a mouse antibody against CCR2. It can be used for CCR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemokine CC-motif receptor type 2; CCR2
UniProt IDA5A4S2
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MGDNDTLALFSYPMLSTPQSLFTSGNQGGNEEPTTNYDYDYSAPCQKTDVRQNAVRLLPPLYSLVFLSGFVGNLLVVLILVNCKKLRGMTDVYLLNLAISDLLFLFTLPFWAHYAANGWVFGDVMCKTVTGLYHVGYFGGNFFIILLTVDRYLAIVHAVFALKARTVTFGAVTSAVTWAAAVVASLPGCVFNKLQWEDSFYSCRPSFPPGWKTFHAVTRSVLGLVLPLLVMIVCYSAILRTLFRCRNEKKKHRAVKLIFVIMIVYFLFWAPNNIVLLLSTFPESFNVSDCQSTSQLDQAMQVTETLGMTHCCINPIIYAFVREKFRRHLSVFFRKHIAKHLCKQCPVFYRETADRVSSTYTPSTGEQEVSAGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry