Mouse Anti-Cat IL6 Antibody (MO-AB-09218W)


Cat: MO-AB-09218W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO09218W
SpecificityThis antibody binds to Cat IL6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cat IL6 Antibody is a mouse antibody against IL6. It can be used for IL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-6; IL6
UniProt IDM3X721
Protein RefseqThe length of the protein is 208 amino acids long.
The sequence is show below: MTFLSTSAFSPLAFSLGLLLVVATAFPTPGPLGGDATSNRLPLTSADKMEELIKYILGKISALKKEMCDNYNKCEDSKEALAENNLNLPKLAEKDGCFQSGFNQETCLTRITTGLQEFQIYLKFLQDKYEGDKENAKSVYTSTNVLLQMLKRKGKNQDEVTIPVPTVEVGLQAKLQSQEEWLRHTTIHLTLRRLEDFLQFSLRAVRIM.
For Research Use Only | Not For Clinical Use.
Online Inquiry