Mouse Anti-Cat ING1 Antibody (MO-AB-07609W)


Cat: MO-AB-07609W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO07609W
SpecificityThis antibody binds to Cat ING1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product OverviewMouse Anti-Cat ING1 Antibody is a mouse antibody against ING1. It can be used for ING1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInhibitor of growth protein; ING1
UniProt IDM3XBZ8
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: IHLVNYVEDYLDSIESLPFDLQRNVSLMRERLQRVSGKKKSEILKELDEYYEKFKRETDGVQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAHQEVNDTTGHSGKAGQDKSKSETVTQAEKTNSKRSRRQRNNENRENAANHHDHDDVTSGTPKEKKAKASKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry