Mouse Anti-Cattle ING1 Antibody (MO-AB-14185R)


Cat: MO-AB-14185R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO14185R
SpecificityThis antibody binds to Cattle ING1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle ING1 Antibody is a mouse antibody against ING1. It can be used for ING1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInhibitor of growth protein; ING1
UniProt IDQ0P5E5
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDEYYERFKREADGAQKRRALHCIQRALIRSQELGDEKIQLVSQMVELVENRARQVDSHVELLEAQQDAADATGHSKAGQDKSKNEAIAQAEKPNNKRSRRQRNNENRENAANNHDHDDVTSGTPKEKKAKASKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLSHKPKGKWYCPKC.
For Research Use Only | Not For Clinical Use.
Online Inquiry