Mouse Anti-Nile tilapia ing1 Antibody (MO-AB-33320H)


Cat: MO-AB-33320H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO33320C
SpecificityThis antibody binds to Nile tilapia ing1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product OverviewThis product is a mouse antibody against ing1. It can be used for ing1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInhibitor of growth protein; LOC100711059
UniProt IDI3KA62
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MLNPTNGDPGHVVVNYVEEYLDLVESLPFDLQRSVSLMKEIDAKYQDVLKELDDAYERYRRESDSLQRRKLQLSIQRALIRSQELGDEKIQIAGQMVELVENRTRQIDWHSELLLSSQEIPESHIPPATSMTTTAASLMSSTSATVTVGKPSHHDKKRDEVTSASGGGEKAGGKRSRRQKNGENRESYGSLDHAEEVGVGASREKKAKTSSKKKKRSKGKSEREVSPPDLPIDPDEPTYCLCEQVSYGEMIGCDNDECPIEWFHFSCVGLHHKPKGKWYCPKCRGENEKTMDKALERAKKERAYNR.
See other products for " ING1 "
MO-AB-31308WMouse Anti-Dog ING1 Antibody (MO-AB-31308W)
MO-AB-06578YMouse Anti-O. anatinus ING1 Antibody (MO-AB-06578Y)
MO-AB-57263WMouse Anti-Marmoset ING1 Antibody (MO-AB-57263W)
MO-AB-14185RMouse Anti-Cattle ING1 Antibody (MO-AB-14185R)
MO-AB-04500HMouse Anti-Frog ing1 Antibody (MO-AB-04500H)
MO-AB-34982WMouse Anti-Ferret ING1 Antibody (MO-AB-34982W)
MO-DKB-01550WRabbit Anti-ING1 Antibody (MO-DKB-01550W)
MO-AB-45165WMouse Anti-Horse ING1 Antibody (MO-AB-45165W)
MO-AB-26537HMouse Anti-Rat Ing1 Antibody (MO-AB-26537H)
CBMOAB-80870FYAMouse Anti-Zebrafish ing1 Antibody (CBMOAB-80870FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry