Mouse Anti-Cat LAMP1 Antibody (MO-AB-07793W)
Cat: MO-AB-07793W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cat (Felis catus) |
Clone | MO07793W |
Specificity | This antibody binds to Cat LAMP1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Lysosome; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Lysosomal associated membrane protein 1 (LAMP-1), also known as lysosomal associated membrane glycoprotein 1 and CD107a (differentiation cluster 107a), is a protein encoded by the LAMP1 gene in the human body. The human LAMP1 gene is located on the long arm (q) of chromosome 13 and is located in region 3, band 4 (13q34).Lysosomal-associated membrane protein 1 is a glycoprotein from the lysosomal-associated membrane glycoprotein family. LAMP-1 glycoprotein is a type I transmembrane protein, expressed at high or moderate levels in at least 76 different normal tissue cell types. It is mainly located on the lysosomal membrane, and plays a role in providing carbohydrate ligand to selectin. CD107a has also been shown to be a degranulation marker for lymphocytes (eg CD8 + and NK cells). and may play a role in the differentiation and metastasis of tumor cells. |
Product Overview | Mouse Anti-Cat LAMP1 Antibody is a mouse antibody against LAMP1. It can be used for LAMP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Lysosomal-associated membrane glycoprotein 1; LAMP-1 |
UniProt ID | C6GGN9 |
Protein Refseq | The length of the protein is 414 amino acids long. The sequence is show below: MAALGGARRRPLFLLLLAGLLHGTAATFVVTDGNGTACIMANFSAAFVTSYDTRNGPTNVTFDLPPDAAVLNSSSSCGKENASAPSLVIAFGRGHRLTLNFTRNATRYSVQLMGFIYNLSDTQIFPNASSKEIKTVESATDIRADINKKYRCVSNNQIHMHNVTVTLHDATIQAYLASSSFSKEETRCEQDGPFPTTAPPPPPRPSPSPTPESPSVHKYNVSGANGTCLLASMGLQLNVTYSKRDNTTVSGLFSIDPSNTSATGSCGPQLVTLDLRSSRIHSLLFQFGMDPNTSQFFLQGIQLNMTVPDARDPTFQADNSSLRALQATIGNSYKCNAEERVEVTEAFSVNIFKVWVQAFQVQGDKFGSVEECQLDENSMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI. |
See other products for " lamp1 "
CBMOAB-82400FYA | Mouse Anti-Zebrafish lamp1 Antibody (CBMOAB-82400FYA) |
CBMOAB-22644FYA | Mouse Anti-D. melanogaster Lamp1 Antibody (CBMOAB-22644FYA) |
MO-AB-10887W | Mouse Anti-Chimpanzee LAMP1 Antibody (MO-AB-10887W) |
MO-AB-14797R | Mouse Anti-Cattle LAMP1 Antibody (MO-AB-14797R) |
MO-NAB-00041W | Mouse Anti-LAMP1 Antibody (MO-NAB-00041W) |
MOMUB-00019W | Rabbit Anti-D. melanogaster LAMP1 (AA 1-100, clone NW0098) Antibody (MOMUB-00019W) |
MO-AB-58037W | Mouse Anti-Marmoset LAMP1 Antibody (MO-AB-58037W) |
MO-AB-04774H | Mouse Anti-Frog lamp1 Antibody (MO-AB-04774H) |
CBMOAB-46749FYA | Mouse Anti-Rhesus LAMP1 Antibody (CBMOAB-46749FYA) |
MO-AB-43226W | Mouse Anti-Hamsters LAMP1 Antibody (MO-AB-43226W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry