Mouse Anti-Hamsters LAMP1 Antibody (MO-AB-43226W)


Cat: MO-AB-43226W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO43226W
SpecificityThis antibody binds to Hamsters LAMP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Lysosome; Endosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPresents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis (By similarity).
Product OverviewMouse Anti-Hamsters LAMP1 Antibody is a mouse antibody against LAMP1. It can be used for LAMP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLysosome-associated membrane glycoprotein 1; LAMP-1; Lysosome-associated membrane protein 1; CD107 antigen-like family member A; Lysosomal membrane glycoprotein A; LGP-A; CD antigen CD107a; LAMP1; LGPA
UniProt IDP49129
Protein RefseqThe length of the protein is407 amino acids long.
The sequence is show below: MAAPGAPRSLLLLLLAGLAHGASALFVVKDSNGTACIMANFSASFFTIYETGHGSKNSTFELPSSAEVLNSNSSCGRENVSEPILTIAFGSGYLLTLNFTRNATRYSVQDMYFAYNLSDTQHFLNASNKGIHSVDSSTDIKADINKTYRCLSAIQVHMGNVTVTLSDATIQAYLLNSNFSKEETRCTQDGPSPTTVPPSPSPPLVPTNPTVIKYNVTGENGTCLLASMALQMNITYMKKDNMTVTRALNISPNDTASGSCSPHVVTLTVESKNSILDLKFGMNGSSSLFFLQEVRLNMTLPDANVSSLMASNQSLRALQATVGNSYKCNTEEHIFVTKEFSLNVFSVQVQAFKVESDRFGSVEECMQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI.
See other products for " LAMP1 "
MOMUB-00019WRabbit Anti-D. melanogaster LAMP1 (AA 1-100, clone NW0098) Antibody (MOMUB-00019W)
MO-AB-07793WMouse Anti-Cat LAMP1 Antibody (MO-AB-07793W)
MOFY-0522-FY41Mouse Anti-LAMP1 Antibody (MOFY-0522-FY41)
MO-NAB-00041WMouse Anti-LAMP1 Antibody (MO-NAB-00041W)
CBMOAB-46749FYAMouse Anti-Rhesus LAMP1 Antibody (CBMOAB-46749FYA)
MO-AB-04774HMouse Anti-Frog lamp1 Antibody (MO-AB-04774H)
MO-AB-58037WMouse Anti-Marmoset LAMP1 Antibody (MO-AB-58037W)
CBMOAB-22644FYAMouse Anti-D. melanogaster Lamp1 Antibody (CBMOAB-22644FYA)
CBMOAB-82400FYAMouse Anti-Zebrafish lamp1 Antibody (CBMOAB-82400FYA)
MO-AB-14797RMouse Anti-Cattle LAMP1 Antibody (MO-AB-14797R)
For Research Use Only | Not For Clinical Use.
Online Inquiry