Mouse Anti-Cat SELL Antibody (MO-AB-09096W)


Cat: MO-AB-09096W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO09096W
SpecificityThis antibody binds to Cat SELL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Cat SELL Antibody is a mouse antibody against SELL. It can be used for SELL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesL-selectin; SELL
UniProt IDA2V6R9
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MSKAKVFPWKCQRAQRDSWNVFRLWVWTVLCCDFLARHGTDCWTYHYSETPMNWAKARKFCQENYTDLVAIQNKGEIEYLEQTLPFSRYYYWIGIRKVGGTWTWVGTNKSLTKEAENWGRGEPNNKKSKEDCVEIYIKRAKDAGKWNDDSCHKQKRALCYTASCQPSSCSNHGECVETINNYTCNCDVGYYGPQCQFVVQCEPLEAPDLGTMDCSHPVGTFSFSSQCTFNCSKGTDLIGVEETTCGPFGNWSSLEPTCQTISCKPLMAPDLGTMDCSHPLANFSFTSTCTFNCLEGTELIGERKIICGPSGIWSSPSPICQKVDQSFSMIKEGNYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSRESVDDPY.
See other products for " SELL "
MO-AB-29026RMouse Anti-Pig SELL Antibody (MO-AB-29026R)
CBMOAB-00143FYAMouse Anti-Goat SELL Antibody (CBMOAB-00143FYA)
CBMOAB-00097FYAMouse Anti-Cattle SELL Antibody (CBMOAB-00097FYA)
CBMOAB-57369FYAMouse Anti-Rhesus SELL Antibody (CBMOAB-57369FYA)
MO-AB-17584YMouse Anti-Sheep SELL Antibody (MO-AB-17584Y)
CBMOAB-97493FYAMouse Anti-Zebrafish sell Antibody (CBMOAB-97493FYA)
MO-AB-64052WMouse Anti-Marmoset SELL Antibody (MO-AB-64052W)
MO-AB-19909RMouse Anti-Cattle SELL Antibody (MO-AB-19909R)
MO-AB-09873YMouse Anti-Rabbit SELL Antibody (MO-AB-09873Y)
MO-AB-33281WMouse Anti-Dog SELL Antibody (MO-AB-33281W)
For Research Use Only | Not For Clinical Use.
Online Inquiry