Mouse Anti-Pig SELL Antibody (MO-AB-29026R)


Cat: MO-AB-29026R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO29026R
SpecificityThis antibody binds to Pig SELL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCalcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
Product OverviewThis product is a mouse antibody against SELL. It can be used for SELL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesL-selectin; SELL
UniProt IDA8R080
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MIFPWKCHSAQRGLWNVFKLWVLTMLCCDFFAYHGTDCWTYHYSEKPMNWMKARKFCQENYTDLVAIQNKGEIEYLNKTLPFSRSYYWIGIRKVEGVWTWVGTNKSLTEEAENWGDGEPNNRKTKEDCVEIYIKRSKDSGKWNDDACHKAKRALCYTASCQPRSCSGHGQCVEVINNYTCNCDAGYYGPQCQFVTQCEPLGDPELGTMACIHPLGKFYFTSQCTFNCSEGTDITGIEETTCGPFGNWSSPEPTCRVILCEPLTAPDLGNMDCSHPLASFGFTSTCTFNCSEGTQLIGEKKTICGSSGNWSSPSPICQKLDRNFSINKEVDYNPLFIPVAVIVTAVSGLAFIIFLARKLKKGKKSQRSMDDPY.
See other products for " SELL "
CBMOAB-00143FYAMouse Anti-Goat SELL Antibody (CBMOAB-00143FYA)
MO-AB-17584YMouse Anti-Sheep SELL Antibody (MO-AB-17584Y)
MO-AB-09873YMouse Anti-Rabbit SELL Antibody (MO-AB-09873Y)
CBMOAB-97493FYAMouse Anti-Zebrafish sell Antibody (CBMOAB-97493FYA)
MO-AB-09096WMouse Anti-Cat SELL Antibody (MO-AB-09096W)
CBMOAB-57369FYAMouse Anti-Rhesus SELL Antibody (CBMOAB-57369FYA)
CBMOAB-00097FYAMouse Anti-Cattle SELL Antibody (CBMOAB-00097FYA)
MO-AB-64052WMouse Anti-Marmoset SELL Antibody (MO-AB-64052W)
MO-AB-19909RMouse Anti-Cattle SELL Antibody (MO-AB-19909R)
MO-AB-33281WMouse Anti-Dog SELL Antibody (MO-AB-33281W)
For Research Use Only | Not For Clinical Use.
Online Inquiry