Mouse Anti-Cat TERT Antibody (MO-AB-09440W)


Cat: MO-AB-09440W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO09440W
SpecificityThis antibody binds to Cat TERT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTelomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity.
Product OverviewMouse Anti-Cat TERT Antibody is a mouse antibody against TERT. It can be used for TERT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTelomerase reverse transcriptase; TERT; TERT
UniProt IDQ7YR69
Protein RefseqThe length of the protein is 79 amino acids long.
The sequence is show below: PSGLRPIVNMDYVVGARTFRRDKKVRHLTSQVKNLFGVLNYERARRPSLLGASVLGMDDIHRVWRSFVLRVRAQDPAPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry