Mouse Anti-Cat TERT Antibody (MO-AB-09440W)
Cat: MO-AB-09440W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cat (Felis catus) |
Clone | MO09440W |
Specificity | This antibody binds to Cat TERT. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity. |
Product Overview | Mouse Anti-Cat TERT Antibody is a mouse antibody against TERT. It can be used for TERT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Telomerase reverse transcriptase; TERT; TERT |
UniProt ID | Q7YR69 |
Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: PSGLRPIVNMDYVVGARTFRRDKKVRHLTSQVKNLFGVLNYERARRPSLLGASVLGMDDIHRVWRSFVLRVRAQDPAPQ. |
See other products for " TERT "
MO-AB-30932H | Mouse Anti-Purple sea urchin TERT Antibody (MO-AB-30932H) |
MO-AB-23795H | Mouse Anti-Mallard TERT Antibody (MO-AB-23795H) |
CBMOAB-09103FYB | Mouse Anti-Zebrafish tert Antibody (CBMOAB-09103FYB) |
MO-AB-04391Y | Mouse Anti-Chicken TERT Antibody (MO-AB-04391Y) |
CBMOAB-60031FYA | Mouse Anti-Rhesus TERT Antibody (CBMOAB-60031FYA) |
MO-AB-33685W | Mouse Anti-Dog TERT Antibody (MO-AB-33685W) |
MO-AB-13407Y | Mouse Anti-O. mykiss TERT Antibody (MO-AB-13407Y) |
MO-AB-06938Y | Mouse Anti-O. anatinus TERT Antibody (MO-AB-06938Y) |
CBMOAB-89656FYB | Mouse Anti-Rice TERT Antibody (CBMOAB-89656FYB) |
MO-AB-46780W | Mouse Anti-Horse TERT Antibody (MO-AB-46780W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry