Mouse Anti-Cattle AGPAT2 Antibody (MO-AB-07130R)


Cat: MO-AB-07130R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07130R
SpecificityThis antibody binds to Cattle AGPAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewMouse Anti-Cattle AGPAT2 Antibody is a mouse antibody against AGPAT2. It can be used for AGPAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1-acylglycerol-3-phosphate O-acyltransferase 2; Lysophosphatidic acid acyltransferase, beta; AGPAT2
UniProt IDQ1RMV6
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MELWPWLIAALLLLLLLAQLSRSARFYAKIGLYCAFCFTASAMAAVVCLLRHGGRTVENMRIISWFVRSFKYAYGLRFEVKGRETLDEDRPCVIISNHQSILDMMGLMEVLPDRCVQISKRELLFLGPVGLIMYLGGVLFINRQHSQTAMSVMTDVGERMVREKLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVIYSSFSSFYSCKTKLFTSGTIQVEVLDAIPTRGLTVADVPKLLDTCHQAMRTH.
For Research Use Only | Not For Clinical Use.
Online Inquiry