Mouse Anti-Pig AGPAT2 Antibody (MO-AB-23629R)


Cat: MO-AB-23629R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23629R
SpecificityThis antibody binds to Pig AGPAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewThis product is a mouse antibody against AGPAT2. It can be used for AGPAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1-acylglycerol-3-phosphate O-acyltransferase 2; AGPAT2
UniProt IDB3VN02
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MDVWPWLSAALLLLLLLVQLSRSAKFYAKIGLYCALCFTVSIVAAATCLLRHGGRTVENMSIISWFVRSFKYLYGLRFEIKGRQRLDEDRSCVIISNHQSILDMMGLMEALPDRCVQIAKRELLFLGPVGLIMYLGGVIFINRQRSQTAVSALADVGERMVREKLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIVPVVYSSFSSFYDSRTKLFTSGTIKVEVLDAVPTRGLTVADIPRLMDTCYQAMRTSFFSISKTPQENGAPAGPAAQPAQ.
See other products for " AGPAT2 "
CBMOAB-35326FYAMouse Anti-Rhesus AGPAT2 Antibody (CBMOAB-35326FYA)
MO-AB-16354WMouse Anti-Chimpanzee AGPAT2 Antibody (MO-AB-16354W)
MO-AB-50596WMouse Anti-Marmoset AGPAT2 Antibody (MO-AB-50596W)
CBMOAB-65213FYAMouse Anti-Zebrafish agpat2 Antibody (CBMOAB-65213FYA)
MO-AB-68781WMouse Anti-Silkworm AGPAT2 Antibody (MO-AB-68781W)
MO-AB-07130RMouse Anti-Cattle AGPAT2 Antibody (MO-AB-07130R)
For Research Use Only | Not For Clinical Use.
Online Inquiry