Mouse Anti-Cattle ALCAM Antibody (MO-AB-07215R)
Cat: MO-AB-07215R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO07215R |
| Specificity | This antibody binds to Cattle ALCAM. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts. Promotes T-cell activation and proliferation via its interactions with CD6 (By similarity). Contributes to the formation and maturation of the immunological synapse via its interactions with CD6 (By similarity). Mediates homotypic interactions with cells that express ALCAM. Mediates attachment of dendritic cells onto endothelial cells via homotypic interaction. Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions. Required for normal organization of the lymph vessel network. Required for normal hematopoietic stem cell engraftment in the bone marrow. Plays a role in hematopoiesis; required for normal numbers of hematopoietic stem cells in bone marrow. Promotes in vitro osteoblast proliferation and differentiation (By similarity). Promotes neurite extension, axon growth and axon guidance; axons grow preferentially on surfaces that contain ALCAM (By similarity). Mediates outgrowth and pathfinding for retinal ganglion cell axons (By similarity). |
| Product Overview | Mouse Anti-Cattle ALCAM Antibody is a mouse antibody against ALCAM. It can be used for ALCAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CD166 antigen; Activated leukocyte cell adhesion molecule; CD antigen CD166; ALCAM |
| UniProt ID | Q9BH13 |
| Protein Refseq | The length of the protein is 583 amino acids long. The sequence is show below: MASKAAPSCRLVFCLLISATVLRPGLGWYTVNSAYGDTIIMPCRVDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNAKISDEKRFVCMLVTEDDVFEAPTVVKVFKQPSKPEIVSKAPFLETDKLKKLGECISKDSYPDGNITWYRNGKVLQALEGAVVIIFRKQMDSVTQLYTMTSSLEYKTTKADIQMPFTCSVTYYGPSGQKTVYSEQAVFDIYYPTEQVTIQVLP. |
See other products for " ALCAM "
| MO-AB-34360W | Mouse Anti-Ferret ALCAM Antibody (MO-AB-34360W) |
| MO-AB-07155Y | Mouse Anti-Rabbit ALCAM Antibody (MO-AB-07155Y) |
| MO-AB-01002W | Mouse Anti-Rhesus ALCAM Antibody (MO-AB-01002W) |
| MO-AB-01346H | Mouse Anti-Frog alcam Antibody (MO-AB-01346H) |
| MOFY-0622-FY207 | Rabbit Anti-ALCAM Antibody (MOFY-0622-FY207) |
| CBMOAB-35474FYA | Mouse Anti-Rhesus ALCAM Antibody (CBMOAB-35474FYA) |
| MO-AB-23674R | Mouse Anti-Pig ALCAM Antibody (MO-AB-23674R) |
| MO-AB-16813W | Mouse Anti-Chimpanzee ALCAM Antibody (MO-AB-16813W) |
| MO-AB-50687W | Mouse Anti-Marmoset ALCAM Antibody (MO-AB-50687W) |
| MO-AB-28913W | Mouse Anti-Dog ALCAM Antibody (MO-AB-28913W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry