Mouse Anti-Ferret ALCAM Antibody (MO-AB-34360W)


Cat: MO-AB-34360W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34360W
SpecificityThis antibody binds to Ferret ALCAM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes activated leukocyte cell adhesion molecule (ALCAM), also known as CD166 (cluster of differentiation 166), which is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular domain. This protein binds to T-cell differentiation antigene CD6, and is implicated in the processes of cell adhesion and migration. Multiple alternatively spliced transcript variants encoding different isoforms have been found.
Product OverviewMouse Anti-Ferret ALCAM Antibody is a mouse antibody against ALCAM. It can be used for ALCAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActivated leukocyte cell adhesion molecule; ALCAM
UniProt IDD7F0A3
Protein RefseqThe length of the protein is 51 amino acids long.
The sequence is show below: KPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry