Mouse Anti-Ferret ALCAM Antibody (MO-AB-34360W)
Cat: MO-AB-34360W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34360W |
Specificity | This antibody binds to Ferret ALCAM. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes activated leukocyte cell adhesion molecule (ALCAM), also known as CD166 (cluster of differentiation 166), which is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular domain. This protein binds to T-cell differentiation antigene CD6, and is implicated in the processes of cell adhesion and migration. Multiple alternatively spliced transcript variants encoding different isoforms have been found. |
Product Overview | Mouse Anti-Ferret ALCAM Antibody is a mouse antibody against ALCAM. It can be used for ALCAM detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Activated leukocyte cell adhesion molecule; ALCAM |
UniProt ID | D7F0A3 |
Protein Refseq | The length of the protein is 51 amino acids long. The sequence is show below: KPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLE. |
See other products for " ALCAM "
MOFY-0622-FY207 | Rabbit Anti-ALCAM Antibody (MOFY-0622-FY207) |
MO-AB-07155Y | Mouse Anti-Rabbit ALCAM Antibody (MO-AB-07155Y) |
MO-AB-16813W | Mouse Anti-Chimpanzee ALCAM Antibody (MO-AB-16813W) |
MO-AB-23674R | Mouse Anti-Pig ALCAM Antibody (MO-AB-23674R) |
MO-AB-28913W | Mouse Anti-Dog ALCAM Antibody (MO-AB-28913W) |
MO-AB-01002W | Mouse Anti-Rhesus ALCAM Antibody (MO-AB-01002W) |
MO-AB-50687W | Mouse Anti-Marmoset ALCAM Antibody (MO-AB-50687W) |
MO-AB-01346H | Mouse Anti-Frog alcam Antibody (MO-AB-01346H) |
MO-AB-07215R | Mouse Anti-Cattle ALCAM Antibody (MO-AB-07215R) |
CBMOAB-35474FYA | Mouse Anti-Rhesus ALCAM Antibody (CBMOAB-35474FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry