Mouse Anti-Cattle AP1M2 Antibody (MO-AB-07434R)


Cat: MO-AB-07434R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07434R
SpecificityThis antibody binds to Cattle AP1M2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle AP1M2 Antibody is a mouse antibody against AP1M2. It can be used for AP1M2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP-1 complex subunit mu-2; AP-mu chain family member mu1B; Adaptor protein complex AP-1 subunit mu-2; Adaptor-related protein complex 1 subunit mu-2; Clathrin assembly protein complex 1 mu-2 medium chain 2; Golgi adaptor HA1/AP1 adaptin mu-2 subunit; Mu-a癷?癸AP1M2
UniProt IDQ3SYW1
Protein RefseqThe length of the protein is 423 amino acids long.
The sequence is show below: MSASAVFILDVKGKPLISRNYKGDVAMSEIDHFMPLLMQREEEGALTPLLSHGRVHFLWIKYSNLYLVATTLKNANASLVYSFLYKIVEVFSEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQGNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGSIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISF.
See other products for " ap1m2 "
CBMOAB-66023FYAMouse Anti-Zebrafish ap1m2 Antibody (CBMOAB-66023FYA)
MO-AB-03373WMouse Anti-Rhesus AP1M2 Antibody (MO-AB-03373W)
CBMOAB-2237FYCMouse Anti-Arabidopsis AP1M2 Antibody (CBMOAB-2237FYC)
MO-AB-50992WMouse Anti-Marmoset AP1M2 Antibody (MO-AB-50992W)
CBMOAB-35923FYAMouse Anti-Rhesus AP1M2 Antibody (CBMOAB-35923FYA)
MO-AB-01461HMouse Anti-Frog ap1m2 Antibody (MO-AB-01461H)
For Research Use Only | Not For Clinical Use.
Online Inquiry