Mouse Anti-Rhesus AP1M2 Antibody (MO-AB-03373W)


Cat: MO-AB-03373W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO03373W
SpecificityThis antibody binds to Rhesus AP1M2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus AP1M2 Antibody is a mouse antibody against AP1M2. It can be used for AP1M2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdaptor Related Protein Complex 1 Mu 2 Subunit; Clathrin Assembly Protein Complex 1 Mu-2 Medium Chain 2; Golgi Adaptor HA1 / AP1 Adaptin Mu-2 Subunit; AP-Mu Chain Family Member Mu1B; Mu-Adaptin 2; Mu1B-Adaptin; Adaptor-Related Protein Complex 1, Mu 2 Subunit; Adaptor-Related Protein Complex 1 Mu 2 Subunit; Adaptor-Related Protein Complex 1 Subunit Mu-2; Clathrin-Associated Adaptor Medium Chain Mu2; Adaptor Protein Complex AP-1 Mu-2 Subunit; Adaptor Protein Complex AP-1 Subunit Mu-2
UniProt IDH9H4V0
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: QVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry