Mouse Anti-Cattle ARPC3 Antibody (MO-AB-07625R)


Cat: MO-AB-07625R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07625R
SpecificityThis antibody binds to Cattle ARPC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Cattle ARPC3 Antibody is a mouse antibody against ARPC3. It can be used for ARPC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin-related protein 2/3 complex subunit 3; Arp2/3 complex 21 kDa subunit; p21-ARC; ARPC3
UniProt IDQ3T035
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry