Mouse Anti-Cattle ATG7 Antibody (MO-AB-07758R)
Cat: MO-AB-07758R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO07758R |
| Specificity | This antibody binds to Cattle ATG7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants. E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes membranes. Required for autophagic death induced by caspase-8 inhibition. Required for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Modulates p53/TP53 activity to regulate cell cycle and survival during metabolic stress. |
| Product Overview | Mouse Anti-Cattle ATG7 Antibody is a mouse antibody against ATG7. It can be used for ATG7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATG7 protein; ATG7 |
| UniProt ID | A4IF80 |
| Protein Refseq | The length of the protein is 699 amino acids long. The sequence is show below: MAAAMGDLGLSRLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSVGLPARLTLEFSAFDMSAPTPARCCPAVGILYNTNTLEAFKAADKKLLLEEAANEIWESIKSGAALDNPVLLNKFLLLTFADLKKYHFYYWFCSPALCLPESIPLIQGPVALDQWFLPKQIQALEHAYDALCQTEGVPALPYFLIKYDETTVLVSSLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNLLVLAAHR. |
See other products for " ATG7 "
| CBMOAB-00394CR | Mouse Anti-Yeast ATG7 Antibody (CBMOAB-00394CR) |
| MO-AB-10488W | Mouse Anti-Chimpanzee ATG7 Antibody (MO-AB-10488W) |
| CBMOAB-36505FYA | Mouse Anti-Rhesus ATG7 Antibody (CBMOAB-36505FYA) |
| MO-DKB-0062RA | Rabbit Anti-ATG7 Antibody (MO-DKB-0062RA) |
| CBMOAB-02010FYA | Mouse Anti-D. melanogaster Atg7 Antibody (CBMOAB-02010FYA) |
| CBMOAB-00756HCB | Mouse Anti-C. elegans ATG7 Antibody (CBMOAB-00756HCB) |
| CBMOAB-24522FYC | Mouse Anti-Arabidopsis ATG7 Antibody (CBMOAB-24522FYC) |
| MO-AB-47422W | Mouse Anti-Maize Atg7 Antibody (MO-AB-47422W) |
| MO-DKB-0061RA | Rabbit Anti-ATG7 Antibody (MO-DKB-0061RA) |
| MO-AB-23919R | Mouse Anti-Pig ATG7 Antibody (MO-AB-23919R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry