Mouse Anti-Cattle ATP6V1A Antibody (MO-AB-07847R)


Cat: MO-AB-07847R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07847R
SpecificityThis antibody binds to Cattle ATP6V1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c'', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle ATP6V1A Antibody is a mouse antibody against ATP6V1A. It can be used for ATP6V1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesV-type proton ATPase catalytic subunit A; V-ATPase subunit A; EC 3.6.3.14; V-ATPase 69 kDa subunit; Vacuolar proton pump subunit alpha; ATP6V1A; ATP6A1 ATP6V1A1
UniProt IDP31404
Protein RefseqThe length of the protein is 617 amino acids long.
The sequence is show below: MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDVKWDFTPCKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGIKEKFSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCG.
For Research Use Only | Not For Clinical Use.
Online Inquiry