Mouse Anti-Cattle BSG Antibody (MO-AB-09152R)


Cat: MO-AB-09152R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09152R
SpecificityThis antibody binds to Cattle BSG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3, SLC16A8, SLC16A11 and SLC16A12 to the plasma membrane. Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
Product OverviewMouse Anti-Cattle BSG Antibody is a mouse antibody against BSG. It can be used for BSG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBasigin; Basigin isoform 2; RPE7 protein; BSG; RPE7
UniProt IDQ3ZBX0
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MAAGQIAVLGLVLLSAQGGFGAGSRIWTNIDNDGSKTRLTCALNHSATEIVGHRWVKGGKVLKEDALPDLKTEYEVDSEDRSGQYSCIFLPEHAGRTDLEVKGPPSIKAVKKSEHATEGETVILVCKSDSFPPVTNWLWYKESESGDQVITNSTQSKFFVVSSESRTELHIPNVDLKEDPGKYVCNGTNLEGTSQAAITLRVRNRFAALWPFLGIVAEVLVLVTIIFIYEKRRKPDEVLDDEDIGSAPLKSSGNP.
For Research Use Only | Not For Clinical Use.
Online Inquiry