Mouse Anti-Frog bsg Antibody (MO-AB-01938H)


Cat: MO-AB-01938H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01938C
SpecificityThis antibody binds to Frog bsg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against bsg. It can be used for bsg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC100037021 protein; LOC100037021
UniProt IDA1L3J1
Protein RefseqThe length of the protein is 387 amino acids long.
The sequence is show below: MGLGLLTLPAVLLLLCGWRAECTAGFIKSPISEVGLTGEAVELHCEAIGRPIPEIQWWFEADYSNNESFSQLWDGAREERVQINATYISHATSTLYVISLIPEDSGTYECRASNDPDRNHLTKIPRIKWIRSQANVMVIDHPDITTDTLYLSEKTVILSCNLSANSLTVSGHRWLKGSKVLKEDKDSSNTMTYNVTGLPGDGSGQYTCEFLTTPDVKQVINVSVSPQVLHLKASEHGNEGDTGVLTCQSNSFPPVTDWAWYIISPNGVEVIGNGSSDRYVIKSTGNQTVLRISNVDIEKDQKDYTCNATNELGSGGDIIHFHVRSRLAALWPFLGIVGEVLVLVTIIFIYEKRRKPDEVCEDEDSATGALKSNSGANNDNLRQRNSN.
See other products for " BSG "
MO-AB-42971WMouse Anti-Hamsters BSG Antibody (MO-AB-42971W)
MO-AB-10416WMouse Anti-Chimpanzee BSG Antibody (MO-AB-10416W)
CBMOAB-67990FYAMouse Anti-Zebrafish bsg Antibody (CBMOAB-67990FYA)
MO-AB-01336WMouse Anti-Rhesus BSG Antibody (MO-AB-01336W)
MO-AB-43870WMouse Anti-Horse BSG Antibody (MO-AB-43870W)
MO-AB-07368YMouse Anti-Rabbit BSG Antibody (MO-AB-07368Y)
MO-AB-09152RMouse Anti-Cattle BSG Antibody (MO-AB-09152R)
CBMOAB-02721FYAMouse Anti-D. melanogaster Bsg Antibody (CBMOAB-02721FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry