Mouse Anti-Cattle CCL11 Antibody (MO-AB-09686R)


Cat: MO-AB-09686R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09686R
SpecificityThis antibody binds to Cattle CCL11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL11 (C-C Motif Chemokine Ligand 11) is a Protein Coding gene. Diseases associated with CCL11 include Asthma and Human Immunodeficiency Virus Type 1. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include chemokine activity. An important paralog of this gene is CCL2.
Product OverviewMouse Anti-Cattle CCL11 Antibody is a mouse antibody against CCL11. It can be used for CCL11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C motif chemokine; CCL11
UniProt IDB3VH90
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: MKVSAVLLCLLLTATLCSIQVLAQPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry