Mouse Anti-Guinea pig CCL11 Antibody (MO-AB-41352W)


Cat: MO-AB-41352W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41352W
SpecificityThis antibody binds to Guinea pig CCL11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL11 (C-C Motif Chemokine Ligand 11) is a Protein Coding gene. Diseases associated with CCL11 include Asthma and Human Immunodeficiency Virus Type 1. Among its related pathways are PEDF Induced Signaling and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include chemokine activity. An important paralog of this gene is CCL2.
Product OverviewMouse Anti-Guinea pig CCL11 Antibody is a mouse antibody against CCL11. It can be used for CCL11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEotaxin; C-C motif chemokine 11; Eosinophil chemotactic protein; Small-inducible cytokine A11; CCL11; SCYA11
UniProt IDP80325
Protein RefseqThe length of the protein is96 amino acids long.
The sequence is show below: MKVSTAFLCLLLTVSAFSAQVLAHPGIPSACCFRVTNKKISFQRLKSYKIITSSKCPQTAIVFEIKPDKMICADPKKKWVQDAKKYLDQISQTTKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry