Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Cattle CD5 Antibody (MO-AB-09869R)


Cat: MO-AB-09869R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09869R
SpecificityThis antibody binds to Cattle CD5.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CD5 (clone MO09869R) Antibody (MO-AB-09869R) is a mouse antibody against CD5. It can be used for CD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD5; CD antigen CD5; CD5
UniProt IDP19238
Protein RefseqThe length of the protein is 495 amino acids long.
The sequence is show below: MGSQHLPLAALYLLELLVTSCLGGLKVEVQGLTMRLSGSGSRCQGRLEVSNGTEWYAVHSQSWGQLSLYQVAPRQFLKLCQELQCRDPLLLSSSRYFKEVQFQKLIICHGQLGSFSNCSLNRGRQVDSLALICLEPPRTTAPPTTSPPTTTPEPTAPPRFQLVAEPGGLRCAGVVEFYSGGLGGTIGIEPQNDIKDLGQLICAALQCGSFLKPLPETEEAQTQKPEGQRPLPIRWEIQNPKCTSLEQCFRKVQPW.

See other products for " CD5 "

CBMOAB-00147FYAMouse Anti-Horse CD5 Antibody (CBMOAB-00147FYA)
CBMOAB-00134FYAMouse Anti-Dog CD5 Antibody (CBMOAB-00134FYA)
CBMOAB-00133FYAMouse Anti-Dog CD5 Antibody (CBMOAB-00133FYA)
MO-AB-14505YMouse Anti-Sheep CD5 Antibody (MO-AB-14505Y)
MOFY-0522-FY69Mouse Anti-CD5 Antibody (MOFY-0522-FY69)
MOFY-0522-FY49Mouse Anti-CD5 Antibody (MOFY-0522-FY49)
CBMOAB-00168FYAMouse Anti-Sheep CD5 Antibody (CBMOAB-00168FYA)
CBMOAB-00041FYAMouse Anti-Cattle CD5 Antibody (CBMOAB-00041FYA)
CBMOAB-00219FYAMouse Anti-Alpaca CD5 Antibody (CBMOAB-00219FYA)
CBMOAB-00042FYAMouse Anti-Cattle CD5 Antibody (CBMOAB-00042FYA)
For Research Use Only | Not For Clinical Use.

Online Inquiry