Mouse Anti-Cattle CD5 Antibody (MO-AB-09869R)


Cat: MO-AB-09869R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details
  • Relate Reference Data

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09869R
SpecificityThis antibody binds to Cattle CD5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAs with human CD5+ B cells, we report here that CD5 is physically associated with the B cell receptor (BCR) in normal bovine CD5+ B cells. In contrast, in CD5+ B cells from BLV-infected PL cattle, CD5 was dissociated from the BCR. In B cells from PL cattle, apoptosis was reduced when cells were stimulated with surface immunoglobulin M (sIgM) antibodies, whereas in B cells from uninfected cattle, apoptosis was increased after sIgM stimulation.
Product OverviewMouse Anti-Cattle CD5 Antibody is a mouse antibody against CD5. It can be used for CD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD5; CD antigen CD5; CD5
UniProt IDP19238
Protein RefseqThe length of the protein is 495 amino acids long.
The sequence is show below: MGSQHLPLAALYLLELLVTSCLGGLKVEVQGLTMRLSGSGSRCQGRLEVSNGTEWYAVHSQSWGQLSLYQVAPRQFLKLCQELQCRDPLLLSSSRYFKEVQFQKLIICHGQLGSFSNCSLNRGRQVDSLALICLEPPRTTAPPTTSPPTTTPEPTAPPRFQLVAEPGGLRCAGVVEFYSGGLGGTIGIEPQNDIKDLGQLICAALQCGSFLKPLPETEEAQTQKPEGQRPLPIRWEIQNPKCTSLEQCFRKVQPW.

Reference

Reference1. Cantor, G. H., Pritchard, S. M., Dequiedt, F., Willems, L., Kettmann, R., & Davis, W. C. (2001). CD5 is dissociated from the B-cell receptor in B cells from bovine leukemia virus-infected, persistently lymphocytotic cattle: consequences to B-cell receptor-mediated apoptosis. Journal of Virology, 75(4), 1689-1696.
2. Stabel, J. R., & Khalifeh, M. S. (2008). Differential expression of CD5 on B lymphocytes in cattle infected with Mycobacterium avium subsp. paratuberculosis. Veterinary immunology and immunopathology, 126(3-4), 211-219.
3. Morrison, W. I., Howard, C. J., & Hinson, C. A. (1991). Polymorphism of the CD4 and CD5 differentiation antigens in cattle. Veterinary immunology and immunopathology, 27(1-3), 235-238.

Figure 1 CD5 coimmunoprecipitates with the BCR in uninfected animals. B cells were enriched from PBMCs by T-cell depletion. Lanes 1 to 3, biotin-labeled cells in 1% digitonin lysis buffer were immunoprecipitated (IP) with either MAb to CD79a (the Ig-alpha component of the BCR) or isotype control MAb AV64A. Precipitates were resuspended in 1% NP-40 lysis buffer, and a second immunoprecipitation was performed using MAb to CD5 (MUCIA) or isotype control MAb. As a control, CD5 was immunoprecipitated directly from the PBMC NP-40 lysate using MAb to CD5 (lane 4).

For Research Use Only | Not For Clinical Use.
Online Inquiry