Mouse Anti-Cattle CD86 Antibody (MO-AB-09886R)


Cat: MO-AB-09886R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09886R
SpecificityThis antibody binds to Cattle CD86.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD86 (CD86 Molecule) is a Protein Coding gene. Diseases associated with CD86 include Gallbladder Squamous Cell Carcinoma and Myocarditis. Among its related pathways are Cytokine Signaling in Immune system and Th2 Differentiation Pathway. Gene Ontology (GO) annotations related to this gene include receptor binding and coreceptor activity. An important paralog of this gene is CD80.
Product OverviewMouse Anti-Cattle CD86 Antibody is a mouse antibody against CD86. It can be used for CD86 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD86 antigen; CD86
UniProt IDQ1JPC5
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MRFKCTMGLRNTLIVMALLLSVSTVPFSGAASLKSHAFFNETGELPCHFPNTQNLSLDELVIFWQDQNKLVLYELFKGQEKPNNVNPKYIGRTSFDQDSWTLRLHNVQIKDTGSYQCFIHHRRSQGLVSIHQMSSDLIVLANFSQPEIRLIANQTEKSNIINLTCSSIQGYPEPQRMYVSLNTTNSSSTYDAVMKKSQSNITELYNVSISVSFPIPPETNVTIFCALQLEPTKIILSQPYNIDAKSPVPSPPVPD.
For Research Use Only | Not For Clinical Use.
Online Inquiry