Mouse Anti-Cattle CDH1 Antibody (MO-AB-09938R)


Cat: MO-AB-09938R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09938R
SpecificityThis antibody binds to Cattle CDH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActivator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C). During telophase and in the subsequent G1 phase of the cell cycle, recognizes and binds proteins containing a destruction box (D-box) and an additional degradation signal termed the KEN box including ASE1, CDC20, the B-type cyclins CLB2 and CLB3, the polo-like kinase CDC5 and HSL1, and recruits them in a C-box-dependent manner to the APC/C for ubiquitination and subsequent proteolysis. Required for exit from mitosis, cytokinesis and formation of prereplicative complexes in G1. Probably is the target of a BUB2-dependent spindle checkpoint pathway.
Product OverviewMouse Anti-Cattle CDH1 Antibody is a mouse antibody against CDH1. It can be used for CDH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCDH1 protein; CDH1
UniProt IDA6QLC4
Protein RefseqThe length of the protein is 883 amino acids long.
The sequence is show below: MGPRCRNLSALLLLLQVSSWLCQEPEPCIPGFGAESYTFTVPRRNLERGRVLGRVSFEGCAGLPRTVYVSDDTRFKVHTDGVLTVRRPVHLHRPELSFLVHAWDSTHRKLSTKVTLEVSAHHHHHHSHHDSPSGTQTEVLTFPGPHHGLRRQKRDWVIPPISCPENEKGPFPKSLVQIKSNKEKETQVFYSITGQGADTPPVGVFIIERETGWLKVTQPLDREQIAKYILFSHAVSSNGQAIEEPMEIVITVTDQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry