Mouse Anti-Cattle CFB Antibody (MO-AB-10107R)


Cat: MO-AB-10107R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10107R
SpecificityThis antibody binds to Cattle CFB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes complement factor B, a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. Polymorphisms in this gene are associated with a reduced risk of age-related macular degeneration. The polyadenylation site of this gene is 421 bp from the 5'' end of the gene for complement component 2.
Product OverviewMouse Anti-Cattle CFB Antibody is a mouse antibody against CFB. It can be used for CFB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement factor B; EC 3.4.21.47; C3/C5 convertase; EC-VMFB; [Cleaved into: Complement factor B Ba fragment; Complement factor B Bb fragment]; CFB; BF
UniProt IDP81187
Protein RefseqThe length of the protein is 761 amino acids long.
The sequence is show below: MGIGHNPRLCLVPLILGLLCGGVGMTPLPEAGPQSPCSLEGVEIKGGSFRLLKAGQVLEYLCPSGFYPYPTQIRTCRSTGSWSTLQTQDRKIVKRAECKAIRCPRPQDFENGEYWPRAAYYNLSDEISFRCYDGYTLRGSANRTCQGNGRWDGETAICDDGATYCPNPGIPLGTRKVGSQYRLEDRVTYYCNRGLTLRGSEQRTCLEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTETIEGVDAEDGHSPGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry